ASCL3 Antibody

Name ASCL3 Antibody
Supplier Novus Biologicals
Catalog NBP1-69172
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ASCL3 (achaete-scute complex homolog 3 (Drosophila)) The peptide sequence was selected from the C terminal of ASCL3. Peptide sequence PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ASCL3
Conjugate Unconjugated
Supplier Page Shop

Product images