Name | ADAMTS19 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69170 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ADAMTS19 (ADAM metallopeptidase with thrombospondin type 1 motif, 19) The peptide sequence was selected from the N terminal of ADAMTS19 (NP_598377). Peptide sequence MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVD |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ADAMTS19 |
Conjugate | Unconjugated |
Supplier Page | Shop |