ADAMTS19 Antibody

Name ADAMTS19 Antibody
Supplier Novus Biologicals
Catalog NBP1-69170
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ADAMTS19 (ADAM metallopeptidase with thrombospondin type 1 motif, 19) The peptide sequence was selected from the N terminal of ADAMTS19 (NP_598377). Peptide sequence MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVD
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ADAMTS19
Conjugate Unconjugated
Supplier Page Shop

Product images