SLC35B1 Antibody
| Name | SLC35B1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69299 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | Synthetic peptides corresponding to SLC35B1(solute carrier family 35, member B1) The peptide sequence was selected from the C terminal of SLC35B1. Peptide sequence ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | SLC35B1 |
| Supplier Page | Shop |
Product images
![Western Blot: SLC35B1 Antibody [NBP1-69299] - This Anti-SLC35B1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4291_SLC35B1%2520Antibody-Western%2520Blot-NBP1-69299-img0001.jpg)
Western Blot: SLC35B1 Antibody [NBP1-69299] - This Anti-SLC35B1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.