MTCH1 Antibody
| Name | MTCH1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69285 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit |
| Antigen | Synthetic peptides corresponding to MTCH1(mitochondrial carrier homolog 1 (C. elegans)) The peptide sequence was selected from the C terminal of MTCH1. Peptide sequence NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MTCH1 |
| Supplier Page | Shop |
Product images
![Western Blot: MTCH1 Antibody [NBP1-69285] - This Anti-MTCH1 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4295_MTCH1%2520Antibody-Western%2520Blot-NBP1-69285-img0001.jpg)
Western Blot: MTCH1 Antibody [NBP1-69285] - This Anti-MTCH1 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.