MRPS33 Antibody

Name MRPS33 Antibody
Supplier Novus Biologicals
Catalog NBP1-74120
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptides corresponding to the middle region of Mrps33. Immunizing peptide sequence DWYPNHNTYFALMGNLRFLGLYRDEHQDFKDEQRRLKKLRGKGKPRKGEG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Mrps33
Conjugate Unconjugated
Supplier Page Shop

Product images