NUDT22 Antibody

Name NUDT22 Antibody
Supplier Novus Biologicals
Catalog NBP1-74263
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to the C terminal of NUDT22. Immunizing peptide sequence FYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NUDT22
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.