TMEM102 Antibody

Name TMEM102 Antibody
Supplier Novus Biologicals
Catalog NBP1-74231
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptides corresponding to the N terminal of Tmem102. Immunizing peptide sequence KDFVFALLGLVHRQDPRFPPQAELLLLRGGIREGSLDLGHAPLGPYSRGP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Tmem102
Conjugate Unconjugated
Supplier Page Shop

Product images