AGXT2 Antibody
| Name | AGXT2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79303 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human AGXT2The immunogen for this antibody is AGXT2. Peptide sequence TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | AGXT2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: AGXT2 Antibody [NBP1-79303] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15718_AGXT2%2520Antibody-Western%2520Blot-NBP1-79303-img0003.jpg)
Western Blot: AGXT2 Antibody [NBP1-79303] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.