TRMT1L Antibody

Name TRMT1L Antibody
Supplier Novus Biologicals
Catalog NBP1-79968
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human C1ORF25. Peptide sequence QAPALSPSLASAPEEAKSKRHISIQRQLADLENLAFVTDGNFDSASSLNS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TRMT1L
Conjugate Unconjugated
Supplier Page Shop

Product images