Cyclin G2 Antibody
| Name | Cyclin G2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79935 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human CCNG2. Peptide sequence MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNT. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CCNG2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Cyclin G2 Antibody [NBP1-79935] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6914_Cyclin-G2-Antibody-Western-Blot-NBP1-79935-img0003.jpg)
![Western Blot: Cyclin G2 Antibody [NBP1-79935] - Jurkat Cell Lysate 2.5ug/ml; Gel Concentration: 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6915_Cyclin-G2-Antibody-Western-Blot-NBP1-79935-img0002.jpg)