OR13C5 Antibody

Name OR13C5 Antibody
Supplier Novus Biologicals
Catalog NBP1-79994
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human OR13C5. Peptide sequence CYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAFD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OR13C5
Conjugate Unconjugated
Supplier Page Shop

Product images