Name | Thyrotropin Releasing Hormone Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-79963 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Bovine, Guinea Pig, Zebrafish |
Antigen | Synthetic peptide directed towards the C terminal of human TRH. Peptide sequence RALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | TRH |
Supplier Page | Shop |