Thyrotropin Releasing Hormone Antibody
| Name | Thyrotropin Releasing Hormone Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79963 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Bovine, Guinea Pig, Zebrafish |
| Antigen | Synthetic peptide directed towards the C terminal of human TRH. Peptide sequence RALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TRH |
| Supplier Page | Shop |
Product images
![Western Blot: Thyrotropin Releasing Hormone Antibody [NBP1-79963] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/4511_Thyrotropin-Releasing-Hormone-Antibody-Western-Blot-NBP1-79963-img0003.jpg)
Western Blot: Thyrotropin Releasing Hormone Antibody [NBP1-79963] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.