MICALL1 Antibody
| Name | MICALL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79460 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human MICALL1The immunogen for this antibody is MICALL1. Peptide sequence ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MICALL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MICALL1 Antibody [NBP1-79460] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml MICALL1 is supported by BioGPS gene expression data to be expressed in HEK293T.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19917_MICALL1-Antibody-Western-Blot-NBP1-79460-img0004.jpg)
Western Blot: MICALL1 Antibody [NBP1-79460] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml MICALL1 is supported by BioGPS gene expression data to be expressed in HEK293T.
![Immunocytochemistry/Immunofluorescence: MICALL1 Antibody [NBP1-79460] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19918_MICALL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-79460-img0003.jpg)
Immunocytochemistry/Immunofluorescence: MICALL1 Antibody [NBP1-79460] - Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic
![Western Blot: MICALL1 Antibody [NBP1-79460] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19919_MICALL1-Antibody-Western-Blot-NBP1-79460-img0002.jpg)
Western Blot: MICALL1 Antibody [NBP1-79460] - Human Liver cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: MICALL1 Antibody [NBP1-79460] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml MICALL1 is supported by BioGPS gene expression data to be expressed in HepG2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19920_MICALL1%2520Antibody-Western%2520Blot-NBP1-79460-img0005.jpg)
Western Blot: MICALL1 Antibody [NBP1-79460] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml MICALL1 is supported by BioGPS gene expression data to be expressed in HepG2.