ANKRA2 Antibody
| Name | ANKRA2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79395 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human ANKRA2The immunogen for this antibody is ANKRA2 (NP_075526). Peptide Sequence: YAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESH |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ANKRA2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ANKRA2 Antibody [NBP1-79395] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15035_ANKRA2%2520Antibody-Western%2520Blot-NBP1-79395-img0003.jpg)
Western Blot: ANKRA2 Antibody [NBP1-79395] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.