FMNL2 Antibody
| Name | FMNL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79264 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human FMNL2The immunogen for this antibody is FMNL2. Peptide sequence MGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKAR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FMNL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: FMNL2 Antibody [NBP1-79264] - Titration: 1.6 ug/ml Positive Control: human cell lines.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7017_FMNL2%2520Antibody-Western%2520Blot-NBP1-79264-img0002.jpg)
![Western Blot: FMNL2 Antibody [NBP1-79264] - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7018_FMNL2%2520Antibody-Western%2520Blot-NBP1-79264-img0001.jpg)