CRISP-1 Antibody
| Name | CRISP-1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79533 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human CRISP1The immunogen for this antibody is CRISP1. Peptide sequence LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CRISP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CRISP1 Antibody [NBP1-79533] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15133_CRISP1%2520Antibody-Western%2520Blot-NBP1-79533-img0002.jpg)
Western Blot: CRISP1 Antibody [NBP1-79533] - 721_B cell lysate, concentration 0.2-1 ug/ml.