PFDN2 Antibody
| Name | PFDN2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79641 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Bovine, Dog, Guinea Pig |
| Antigen | Synthetic peptide directed towards the middle region of human PFDN2The immunogen for this antibody is PFDN2. Peptide sequence LTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLV. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PFDN2 |
| Supplier Page | Shop |
Product images
![Western Blot: PFDN2 Antibody [NBP1-79641] - Jurkat Cell Lysate 1ug/ml Gel concentration 10-20%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4416_PFDN2%2520Antibody-Western%2520Blot-NBP1-79641-img0001.jpg)
Western Blot: PFDN2 Antibody [NBP1-79641] - Jurkat Cell Lysate 1ug/ml Gel concentration 10-20%