FAM126A Antibody

Name FAM126A Antibody
Supplier Novus Biologicals
Catalog NBP1-79800
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human FAM126AThe immunogen for this antibody is FAM126A. Peptide sequence MEISEVDEGFYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FAM126A
Conjugate Unconjugated
Supplier Page Shop

Product images