Name | KCTD7 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-80094 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide directed towards the N terminal of human KCTD7 containing the following sequence: VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE. Peptide sequence VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | KCTD7 |
Conjugate | Unconjugated |
Supplier Page | Shop |