KCTD7 Antibody
| Name | KCTD7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80094 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human KCTD7 containing the following sequence: VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE. Peptide sequence VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | KCTD7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: KCTD7 Antibody [NBP1-80094] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14557_KCTD7-Antibody-Western-Blot-NBP1-80094-img0004.jpg)
Western Blot: KCTD7 Antibody [NBP1-80094] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
![Western Blot: KCTD7 Antibody [NBP1-80094] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14558_KCTD7-Antibody-Western-Blot-NBP1-80094-img0002.jpg)
Western Blot: KCTD7 Antibody [NBP1-80094] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: KCTD7 Antibody [NBP1-80094] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14559_KCTD7-Antibody-Western-Blot-NBP1-80094-img0003.jpg)
Western Blot: KCTD7 Antibody [NBP1-80094] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
![Western Blot: KCTD7 Antibody [NBP1-80094] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14560_KCTD7%2520Antibody-Western%2520Blot-NBP1-80094-img0005.jpg)
Western Blot: KCTD7 Antibody [NBP1-80094] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.