CLIC6 Antibody

Name CLIC6 Antibody
Supplier Novus Biologicals
Catalog NBP1-80089
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human CLIC6. Peptide sequence RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLIC6
Conjugate Unconjugated
Supplier Page Shop

Product images