ZNF621 Antibody

Name ZNF621 Antibody
Supplier Novus Biologicals
Catalog NBP1-80005
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human ZNF621. Peptide sequence ECKECGKGLSSNTALTQHQRIHTGEKPYECKECGKAFRRSAAYLQHQRLH.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ZNF621
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.