ZNF683 Antibody
| Name | ZNF683 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80185 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF683. Peptide sequence PAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQP. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF683 |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF683 Antibody [NBP1-80185] - Titration: 1.25ug/ml, Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4474_ZNF683%2520Antibody-Western%2520Blot-NBP1-80185-img0003.jpg)
Western Blot: ZNF683 Antibody [NBP1-80185] - Titration: 1.25ug/ml, Positive Control: HepG2 cell lysate.
![Immunohistochemistry-Paraffin: ZNF683 Antibody [NBP1-80185] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4475_ZNF683%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80185-img0002.jpg)
Immunohistochemistry-Paraffin: ZNF683 Antibody [NBP1-80185] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.