ZNF266 Antibody
| Name | ZNF266 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80114 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF266. Peptide sequence: EESRTVQRGDFQASEWKVQLKTKELALQQDVLGEPTSSGIQMIGSHNGGE |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF266 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ZNF266 Antibody [NBP1-80114] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24634_ZNF266%2520Antibody-Western%2520Blot-NBP1-80114-img0001.jpg)
![Immunohistochemistry-Paraffin: ZNF266 Antibody [NBP1-80114] - Human Cerebellum, antibody concentration 4-8ug/ml. Cells with positive label: Purkinje cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24635_ZNF266%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80114-img0002.jpg)