KLF14 Antibody

Name KLF14 Antibody
Supplier Novus Biologicals
Catalog NBP1-80141
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human KLF14. Peptide sequence SAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KLF14
Conjugate Unconjugated
Supplier Page Shop

Product images