ZNF551 Antibody
| Name | ZNF551 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80139 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF551. Peptide sequence FVTGCRFHVLNYFTCGEAFPAPTDLLQHEATPSGEEPHSSSSKHIQAFFN. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF551 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ZNF551 Antibody [NBP1-80139] - Jurkat cell lysate, Antibody Titration: 0.6ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24698_ZNF551-Antibody-Western-Blot-NBP1-80139-img0001.jpg)
![Immunohistochemistry-Paraffin: ZNF551 Antibody [NBP1-80139] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24699_ZNF551-Antibody-Immunohistochemistry-Paraffin-NBP1-80139-img0003.jpg)