STAT5b Antibody
| Name | STAT5b Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80232 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of mouse STAT5B. Peptide sequence GTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFDSQFSVGGNELVFQV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | Stat5b |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: STAT5b Antibody [NBP1-80232] - Human Muscle Lysate 5ug/ml Gel Concentration 8%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24414_STAT5b-Antibody-Western-Blot-NBP1-80232-img0001.jpg)
![Immunohistochemistry: STAT5b Antibody [NBP1-80232] - Staining of human prostate section.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24415_STAT5b-Antibody-Immunohistochemistry-NBP1-80232-img0002.jpg)
![Immunohistochemistry: STAT5b Antibody [NBP1-80232] - Staining of human prostate cross section.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24416_STAT5b%2520Antibody-Immunohistochemistry-NBP1-80232-img0003.jpg)