ASTE1 Antibody

Name ASTE1 Antibody
Supplier Novus Biologicals
Catalog NBP1-80291
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptide directed towards the middle region of human Aste1. Peptide sequence YHRVLGLLNWLSHFDDPTEALDNVLKSLPKKSRENVKELLCCSMEEYQQS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Aste1
Conjugate Unconjugated
Supplier Page Shop

Product images