KCTD6 Antibody

Name KCTD6 Antibody
Supplier Novus Biologicals
Catalog NBP1-80273
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human KCTD6. Peptide sequence: LRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVV
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene KCTD6
Conjugate Unconjugated
Supplier Page Shop

Product images