ZNF419A Antibody

Name ZNF419A Antibody
Supplier Novus Biologicals
Catalog NBP1-80366
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Sheep
Antigen Synthetic peptide directed towards the C terminal of human ZNF419A. Peptide sequence GRLFRENSSLVKHQRVHTGAKPYECRECGKFFRHNSSLFKHRRIHTGEMQ.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene ZNF419
Supplier Page Shop

Product images