RPL32 Antibody
| Name | RPL32 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80442 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human RPL32. Peptide sequence AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | RPL32 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RPL32 Antibody [NBP1-80442] - HepG2 cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17271_RPL32%2520Antibody-Western%2520Blot-NBP1-80442-img0002.jpg)
Western Blot: RPL32 Antibody [NBP1-80442] - HepG2 cell lysate, concentration 2.5 ug/ml.