ZNF567 Antibody
| Name | ZNF567 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80412 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Pig, Dog, Horse, Rabbit |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF567. Peptide sequence TSFAGHTCLEENWKAEDFLVKFKEHQEKYSRSVVSINHKKLVKEKSKIYE. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF567 |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF567 Antibody [NBP1-80412] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4521_ZNF567%2520Antibody-Western%2520Blot-NBP1-80412-img0003.jpg)
Western Blot: ZNF567 Antibody [NBP1-80412] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.