Name | ZNF567 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-80412 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Pig, Dog, Horse, Rabbit |
Antigen | Synthetic peptide directed towards the N terminal of human ZNF567. Peptide sequence TSFAGHTCLEENWKAEDFLVKFKEHQEKYSRSVVSINHKKLVKEKSKIYE. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | ZNF567 |
Supplier Page | Shop |