FEZF1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-91367
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the C terminal of human FEZF1. Peptide sequence CPTCGKGFCRNFDLKKHVRKLHDSSLGLARTPAGEPGTEPPPPLPQQPPM.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: FEZF1
• Conjugate: Unconjugated

Product images

Western Blot: FEZF1 Antibody [NBP1-91367] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: FEZF1 Antibody [NBP1-91367] - Staining of human placenta section.

Western Blot: FEZF1 Antibody [NBP1-91367] - Hela Cell Lysate 1ug/ml Gel Concentration 12%

Immunohistochemistry: FEZF1 Antibody [NBP1-91367] - Staining of human pancreas section.

Immunohistochemistry: FEZF1 Antibody [NBP1-91367] - Staining of human pancreas section.