TYW5 Antibody

Name TYW5 Antibody
Supplier Novus Biologicals
Catalog NBP1-91416
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen Synthetic peptide directed towards the middle region of human C2orf60. Peptide sequence NKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene TYW5
Supplier Page Shop

Product images