ARHGAP19 Antibody

Name ARHGAP19 Antibody
Supplier Novus Biologicals
Catalog NBP1-91513
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human ARHGAP19. Peptide sequence: QFNKQSLTQTPGREPSTSQVQKRARSRSFSGLIKRKVLGNQMMSEKKKKN
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARHGAP19
Conjugate Unconjugated
Supplier Page Shop

Product images