SLC48A1 Antibody
| Name | SLC48A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91563 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human FLJ20489. Peptide sequence LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKV. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC48A1 |
| Supplier Page | Shop |
![Western Blot: SLC48A1 Antibody [NBP1-91563] - HepG2 cell lysate, Antibody Titration: 0.0625ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4568_SLC48A1%2520Antibody-Western%2520Blot-NBP1-91563-img0001.jpg)
![Immunohistochemistry-Paraffin: SLC48A1 Antibody [NBP1-91563] - Human Placenta Decidual cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4569_SLC48A1%2520Antibody-Immunohistochemistry-Paraffin-NBP1-91563-img0002.jpg)