FOXO6 Antibody

Name FOXO6 Antibody
Supplier Novus Biologicals
Catalog NBP1-91611
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptide directed towards the N terminal of human FOXO6. Peptide sequence KTPRRRAVSMDNGAKFLRIKGKASKKKQLHLPERSPDDSPPGAPVPGPLS.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene Foxo6
Conjugate Unconjugated
Supplier Page Shop

Product images