ESYT3 Antibody
| Name | ESYT3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91354 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human FAM62C. Peptide sequence RNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ESYT3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ESYT3 Antibody [NBP1-91354] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15867_ESYT3-Antibody-Western-Blot-NBP1-91354-img0004.jpg)
Western Blot: ESYT3 Antibody [NBP1-91354] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.