Name | PPP3CB Antibody (5D3) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00005532-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG1 Kappa |
Clone | 5D3 |
Applications | WB ELISA Gene Silencing |
Species Reactivities | Human |
Antigen | PPP3CB (NP_066955 435 a.a. - 524 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | PPP3CB |
Conjugate | Unconjugated |
Supplier Page | Shop |