Glycogenin 1 Antibody (2C10)

• Supplier: Novus Biologicals
• Catalog: H00002992-M08
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone: 2C10
• Applications: WB ELISA
• Species Reactivities: Human, Rat
• Antigen: GYG1 (NP_004121, 1 a.a. - 73 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: GYG1
• Conjugate: Unconjugated