GRID1 Antibody (1A9)
| Name | GRID1 Antibody (1A9) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00002894-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone | 1A9 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | GRID1 (NP_060021, 349 a.a. - 441 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | GRID1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GRID1 Antibody (1A9) [H00002894-M01] - GRID1 monoclonal antibody (M01), clone 1A9 Analysis of GRID1 expression in HeLa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/28063_GRID1%2520Antibody%2520(1A9)-Western%2520Blot-H00002894-M01-img0004.jpg)
![Sandwich ELISA: GRID1 Antibody (1A9) [H00002894-M01] - Detection limit for recombinant GST tagged GRID1 is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/28064_GRID1-Antibody-(1A9)-Sandwich-ELISA-H00002894-M01-img0003.jpg)