ZNF232 Antibody (1F8)
| Name | ZNF232 Antibody (1F8) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00007775-M06 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 1F8 |
| Applications | WB ELISA IHC-P |
| Species Reactivities | Human |
| Antigen | ZNF232 (NP_055334.2, 181 a.a. - 280 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EKKESLGAAQEALSIQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLRWSP |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | ZNF232 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF232 Antibody (1F8) [H00007775-M06] - Analysis of ZNF232 expression in transfected 293T cell line by ZNF232 monoclonal antibody (M06), clone 1F8. Lane 1: ZNF232 transfected lysatE (50.7 KDa). Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/26358_ZNF232%2520Antibody%2520(1F8)-Western%2520Blot-H00007775-M06-img0004.jpg)
Western Blot: ZNF232 Antibody (1F8) [H00007775-M06] - Analysis of ZNF232 expression in transfected 293T cell line by ZNF232 monoclonal antibody (M06), clone 1F8. Lane 1: ZNF232 transfected lysatE (50.7 KDa). Lane 2: Non-transfected lysate.
![Immunohistochemistry-Paraffin: ZNF232 Antibody (1F8) [H00007775-M06] - Analysis of monoclonal antibody to ZNF232 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/26359_ZNF232-Antibody-(1F8)-Immunohistochemistry-Paraffin-H00007775-M06-img0002.jpg)
Immunohistochemistry-Paraffin: ZNF232 Antibody (1F8) [H00007775-M06] - Analysis of monoclonal antibody to ZNF232 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
![Sandwich ELISA: ZNF232 Antibody (1F8) [H00007775-M06] - Detection limit for recombinant GST tagged ZNF232 is 1 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/26360_ZNF232-Antibody-(1F8)-Sandwich-ELISA-H00007775-M06-img0003.jpg)
Sandwich ELISA: ZNF232 Antibody (1F8) [H00007775-M06] - Detection limit for recombinant GST tagged ZNF232 is 1 ng/ml as a capture antibody.