DUSP22 Antibody (3D3)
| Name | DUSP22 Antibody (3D3) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00056940-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 3D3 |
| Applications | WB ELISA Gene Silencing |
| Species Reactivities | Human |
| Antigen | DUSP22 (NP_064570, 112 a.a. ~ 185 a.a) partial recombinant protein with GST tag.EDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEE YGESPLQDAEEAKNILAAPGILKFWAFLRRL |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | DUSP22 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DUSP22 Antibody (3D3) [H00056940-M01] - Analysis of DUSP22 over-expressed 293 cell line, cotransfected with DUSP22 Validated Chimera RNAi ( Cat # H00056940-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DUSP22 monoclonal antibody (M01), clone 3D3 (Cat # H00056940-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/22546_DUSP22-Antibody-(3D3)-Western-Blot-H00056940-M01-img0003.jpg)
Western Blot: DUSP22 Antibody (3D3) [H00056940-M01] - Analysis of DUSP22 over-expressed 293 cell line, cotransfected with DUSP22 Validated Chimera RNAi ( Cat # H00056940-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DUSP22 monoclonal antibody (M01), clone 3D3 (Cat # H00056940-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
![Western Blot: DUSP22 Antibody (3D3) [H00056940-M01] - Analysis of DUSP22 expression in transfected 293T cell line by DUSP22 monoclonal antibody (M01), clone 3D3.Lane 1: DUSP22 transfected lysate(20.9 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/22547_DUSP22%2520Antibody%2520(3D3)-Western%2520Blot-H00056940-M01-img0004.jpg)
Western Blot: DUSP22 Antibody (3D3) [H00056940-M01] - Analysis of DUSP22 expression in transfected 293T cell line by DUSP22 monoclonal antibody (M01), clone 3D3.Lane 1: DUSP22 transfected lysate(20.9 KDa).Lane 2: Non-transfected lysate.