PEX16 Antibody
| Name | PEX16 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85828 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PEX16 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PEX16 |
| Supplier Page | Shop |
![Western Blot: PEX16 Antibody [NBP1-85828] - Lane 1: Mouse liver tissue lysate<br/>Lane 2: Rat liver tissue lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/1532_PEX16%2520Antibody-Western%2520Blot-NBP1-85828-img0003.jpg)
![Immunohistochemistry-Paraffin: PEX16 Antibody [NBP1-85828] - Staining of human stomach, lower shows strong membranous and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/1533_PEX16-Antibody-Immunohistochemistry-Paraffin-NBP1-85828-img0002.jpg)