CREG2 Antibody
| Name | CREG2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86262 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RCVQLTLTGQMIAVSPEEVEFAKQAMFSRHPGMRKWPRQYEWFFMKMRIEHIWLQKWYGGASSISREEYFKAVP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CREG2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CREG2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunohistochemistry: CREG2 Antibody [NBP1-86262] - Staining of human cerebral cortex shows distinct positivity in processes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20457_CREG2-Antibody-Immunohistochemistry-NBP1-86262-img0004.jpg)
![Immunohistochemistry: CREG2 Antibody [NBP1-86262] - Staining of human hippocampus shows distinct staining in neurofilaments and moderate positivity in neurons.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20458_CREG2-Antibody-Immunohistochemistry-NBP1-86262-img0003.jpg)