SREB3 Antibody
| Name | SREB3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87002 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human, Mouse |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KPVQMVPAISQNWTFHGPGATGQAAANWIAGFGRGPMPPTLLGIRQNGHAASRRLLGMDEVKGEKQLGRMFY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SREB3 Protein |
| Description | Rabbit Polyclonal |
| Gene | GPR173 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SREB3 Antibody [NBP1-87002] - Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/12230_SREB3-Antibody-Immunohistochemistry-NBP1-87002-img0003.jpg)
Immunohistochemistry: SREB3 Antibody [NBP1-87002] - Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.