ST3GAL3 Antibody

Name ST3GAL3 Antibody
Supplier Novus Biologicals
Catalog NBP2-13389
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKY ANFSEGACKPGYASALMTAIF
Purity/Format Immunogen affinity purified
Blocking Peptide ST3GAL3 Protein
Description Rabbit Polyclonal
Gene ST3GAL3
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.