CALY Antibody
| Name | CALY Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91225 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CALY Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CALY |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CALY Antibody [NBP1-91225] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26481_CALY%2520Antibody-Western%2520Blot-NBP1-91225-img0006.jpg)
Western Blot: CALY Antibody [NBP1-91225] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
![Immunohistochemistry-Paraffin: CALY Antibody [NBP1-91225] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26482_CALY-Antibody-Immunohistochemistry-Paraffin-NBP1-91225-img0005.jpg)
Immunohistochemistry-Paraffin: CALY Antibody [NBP1-91225] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
![Immunohistochemistry: CALY Antibody [NBP1-91225] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26483_CALY-Antibody-Immunohistochemistry-NBP1-91225-img0004.jpg)
Immunohistochemistry: CALY Antibody [NBP1-91225] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.