SNRPA1 Antibody
| Name | SNRPA1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33528 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: IEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SNRPA1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SNRPA1 |
| Supplier Page | Shop |
![Immunohistochemistry-Paraffin: SNRPA1 Antibody [NBP2-33528] - Immunohistochemical staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/12351_SNRPA1-Antibody-Immunohistochemistry-Paraffin-NBP2-33528-img0001.jpg)
![Immunohistochemistry-Paraffin: SNRPA1 Antibody [NBP2-33528] - breast cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/12352_SNRPA1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33528-img0002.jpg)