BOP1 Antibody
| Name | BOP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33520 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RCVRTVPVGGVVKSVAWNPSPAVCLVAAAVEDSVLLLNPALGDRLVAGSTDQLLSAFVPPEEPPLQPARWLEASEEERQVGLRLRICHGKP |
| Description | Rabbit Polyclonal |
| Gene | BOP1 |
| Supplier Page | Shop |
![Immunohistochemistry-Paraffin: BOP1 Antibody [NBP2-33520] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/12353_BOP1-Antibody-Immunohistochemistry-Paraffin-NBP2-33520-img0001.jpg)
![Immunohistochemistry-Paraffin: BOP1 Antibody [NBP2-33520] - colon](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/12354_BOP1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33520-img0002.jpg)