FAM177A1 Antibody
| Name | FAM177A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33293 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: NRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVSVP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM177A1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM177A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FAM177A1 Antibody [NBP2-33293] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6754_FAM177A1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33293-img0004.jpg)
Immunocytochemistry/Immunofluorescence: FAM177A1 Antibody [NBP2-33293] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & vesicles.
![Immunohistochemistry: FAM177A1 Antibody [NBP2-33293] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6755_FAM177A1-Antibody-Immunohistochemistry-NBP2-33293-img0001.jpg)
Immunohistochemistry: FAM177A1 Antibody [NBP2-33293] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.